PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT12240
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family Dof
Protein Properties Length: 315aa    MW: 33195.7 Da    PI: 8.179
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT12240genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof108.24.2e-34102157560
    zf-Dof   5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                l+cprCds ntkfCy+nnys +qPr+fC+aCrryWt+GGalrnvPvG+  r++ k
  EMT12240 102 GLNCPRCDSINTKFCYFNNYSFTQPRHFCRACRRYWTRGGALRNVPVGSVYRRHAK 157
               579**********************************************9998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-3083157IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.521103157IPR003851Zinc finger, Dof-type
PfamPF027011.5E-29103156IPR003851Zinc finger, Dof-type
PROSITE patternPS013610105141IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MIFPPTFLDS SNCWNTNHNQ PQLQEIGNNT HITTIPSPAG HDDGGGDNSN EGGLMATAGA  60
GAGRGDHGGV GAEYGHGGSR NSKPMSMSDR ARLARVPPPV PGLNCPRCDS INTKFCYFNN  120
YSFTQPRHFC RACRRYWTRG GALRNVPVGS VYRRHAKCRD KRKTTSAASE AAATGTSSTT  180
SMTSSSTSCA IGTGTAAPGL QSSMFRRGFA DSFDPASLGL SFPAGLLFAD SGAYAADGCV  240
QQHHDQAHGN RMEQWAAAQI DSFPFMHAMD NQMSGPPTEA MPITMAAMRG MFHFHLGPRS  300
GGGGNGDDGN GASLP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014753866.18e-54PREDICTED: dof zinc finger protein DOF3.2-like
TrEMBLM8BEW50.0M8BEW5_AEGTA; Dof zinc finger protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.11e-33OBF-binding protein 3